DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EloB and RGD1304870

DIOPT Version :9

Sequence 1:NP_524416.1 Gene:EloB / 42435 FlyBaseID:FBgn0023212 Length:118 Species:Drosophila melanogaster
Sequence 2:XP_038943766.1 Gene:RGD1304870 / 287912 RGDID:1304870 Length:138 Species:Rattus norvegicus


Alignment Length:124 Identity:55/124 - (44%)
Similarity:82/124 - (66%) Gaps:10/124 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDVFLMIRRQKTTIFTDAKENTTVAELKRMIEGILKVQPVDQRLYNQDNDVMEDDSTLQDYGVTV 65
            |:|||||||:|||||.:|:|::||.||||:::||||..|.:|.|: :|:.::::..||:|.|.|.
  Rat     1 MEVFLMIRRKKTTIFAEAQESSTVLELKRIVQGILKRPPEEQLLF-KDDQLLDESKTLRDCGFTS 64

  Fly    66 STAKAQAPAQLGLTFRNEVGDFETLDMTPYSAPPDLPEVMK------NQEASNGQEQVA 118
            ..||||.||.:.|.||.:..  |.:.:.|||.|. ||.|||      :.|..:|.:.::
  Rat    65 QIAKAQDPATVALVFREDAS--EGVQIHPYSTPL-LPSVMKTGTDSLSDEIKSGLDSLS 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EloBNP_524416.1 Ubl_ElonginB 2..104 CDD:340486 49/101 (49%)
RGD1304870XP_038943766.1 Ubl_ElonginB 2..100 CDD:340486 49/101 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342337
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13248
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.