DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5412 and FSH1

DIOPT Version :9

Sequence 1:NP_650895.1 Gene:CG5412 / 42434 FlyBaseID:FBgn0038806 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_011915.1 Gene:FSH1 / 856445 SGDID:S000001091 Length:243 Species:Saccharomyces cerevisiae


Alignment Length:245 Identity:61/245 - (24%)
Similarity:96/245 - (39%) Gaps:41/245 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RVLCLHGYRQNGEAFKNKLGSFRKFANK-YAEFVFITAPHVAKALESAAEPVP-EQRSWWANKDD 94
            ::|.|||:.|||:.|..|....||...| ..:..:|.||.:   ||....|.. :...|.|..| 
Yeast     7 KLLFLHGFLQNGKVFSEKSSGIRKLLKKANVQCDYIDAPVL---LEKKDLPFEMDDEKWQATLD- 67

  Fly    95 GSFKGTNKG-------GPAFGFQESLRCVEEAWRTQGPFQGLLGFSQGACFVGLICGLAKKKLTS 152
               ...|:.       .......|.|:.|.:..:..||:.|::||||||....:|.... .:|..
Yeast    68 ---ADVNRAWFYHSEISHELDISEGLKSVVDHIKANGPYDGIVGFSQGAALSSIITNKI-SELVP 128

  Fly   153 IRPEF--AVLASGFL--------SGSLVHMSAYEEAISI------PTLHIYGQTDEIIPKEMSES 201
            ..|:|  :|:.||:.        .|.|.....:.::.::      ..:.|||.:|:.:|...|:.
Yeast   129 DHPQFKVSVVISGYSFTEPDPEHPGELRITEKFRDSFAVKPDMKTKMIFIYGASDQAVPSVRSKY 193

  Fly   202 LAARFKNAE--------VLEHSGGHYFPATAQQKQTFINFFQDRLQEYLE 243
            |...:..|:        ..||.|||..|......:..:......|||..|
Yeast   194 LYDIYLKAQNGNKEKVLAYEHPGGHMVPNKKDIIRPIVEQITSSLQEASE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5412NP_650895.1 FSH1 28..230 CDD:281892 57/230 (25%)
MhpC <177..244 CDD:223669 18/81 (22%)
FSH1NP_011915.1 FSH1 6..229 CDD:397863 57/229 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344598
Domainoid 1 1.000 64 1.000 Domainoid score I2426
eggNOG 1 0.900 - - E1_KOG2551
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I1717
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002782
OrthoInspector 1 1.000 - - otm46639
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R361
SonicParanoid 1 1.000 - - X2182
TreeFam 1 0.960 - -
1110.880

Return to query results.
Submit another query.