DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5412 and FSH2

DIOPT Version :9

Sequence 1:NP_650895.1 Gene:CG5412 / 42434 FlyBaseID:FBgn0038806 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_013949.1 Gene:FSH2 / 855262 SGDID:S000004835 Length:223 Species:Saccharomyces cerevisiae


Alignment Length:213 Identity:60/213 - (28%)
Similarity:90/213 - (42%) Gaps:35/213 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VLCLHGYRQNGEAFKNKLGSFRKFANKYA-EFVFITAPHVAKALESAAEPVPEQRSWWANK--DD 94
            ||.|||..|:|:.|.:|...||....|.. :..:.|||:     |.....||:    :..:  .|
Yeast     5 VLMLHGLAQSGDYFASKTKGFRAEMEKLGYKLYYPTAPN-----EFPPADVPD----FLGEVIAD 60

  Fly    95 GSFKGTNKG-----------GPAFGFQESLRCVEEAWRTQGPFQGLLGFSQGACFVGLIC----- 143
            ....|.|.|           |..|..|.::..:.......|||.|::||||||...|.:.     
Yeast    61 APGDGENTGVLAWLENDPSTGGYFIPQTTIDYLHNYVLENGPFAGIVGFSQGAGVAGYLATDFNG 125

  Fly   144 --GLAKKKLTSIRPEFAVLASGFLSGSLVHMSAYE-EAISIPTLHIYGQTDEIIPKEMSESL--A 203
              ||..::...:  ||.:..|||......:...|: ..||:|:||:.|:.|.|......:.|  :
Yeast   126 LLGLTTEEQPPL--EFFMAVSGFRFQPQQYQEQYDLHPISVPSLHVQGELDTITEPAKVQGLYNS 188

  Fly   204 ARFKNAEVLEHSGGHYFP 221
            ....:..:|.|||||:.|
Yeast   189 CTEDSRTLLMHSGGHFVP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5412NP_650895.1 FSH1 28..230 CDD:281892 60/213 (28%)
MhpC <177..244 CDD:223669 16/47 (34%)
FSH2NP_013949.1 FSH1 1..214 CDD:397863 60/213 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344597
Domainoid 1 1.000 64 1.000 Domainoid score I2426
eggNOG 1 0.900 - - E1_KOG2551
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I1717
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002782
OrthoInspector 1 1.000 - - otm46639
orthoMCL 1 0.900 - - OOG6_102370
Panther 1 1.100 - - O PTHR48070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R361
SonicParanoid 1 1.000 - - X2182
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.