DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5412 and DFR1

DIOPT Version :10

Sequence 1:NP_650895.1 Gene:CG5412 / 42434 FlyBaseID:FBgn0038806 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_014879.1 Gene:DFR1 / 854411 SGDID:S000005762 Length:211 Species:Saccharomyces cerevisiae


Alignment Length:53 Identity:11/53 - (20%)
Similarity:20/53 - (37%) Gaps:6/53 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 IPKEMSESLAARFKNAEVLEHSGGHYFPATAQQKQTFINFFQDRLQEYLEHEE 246
            :|..|:..::..||:..|      |....:..|..:..|...:....:.||.|
Yeast    71 LPNRMNVIISRSFKDDFV------HDKERSIVQSNSLANAIMNLESNFKEHLE 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5412NP_650895.1 FSH1 28..229 CDD:461110 7/34 (21%)
DFR1NP_014879.1 DHFR 8..208 CDD:238127 11/53 (21%)

Return to query results.
Submit another query.