powered by:
Protein Alignment CG5412 and DFR1
DIOPT Version :9
Sequence 1: | NP_650895.1 |
Gene: | CG5412 / 42434 |
FlyBaseID: | FBgn0038806 |
Length: | 279 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_014879.1 |
Gene: | DFR1 / 854411 |
SGDID: | S000005762 |
Length: | 211 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 53 |
Identity: | 11/53 - (20%) |
Similarity: | 20/53 - (37%) |
Gaps: | 6/53 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 194 IPKEMSESLAARFKNAEVLEHSGGHYFPATAQQKQTFINFFQDRLQEYLEHEE 246
:|..|:..::..||:..| |....:..|..:..|...:....:.||.|
Yeast 71 LPNRMNVIISRSFKDDFV------HDKERSIVQSNSLANAIMNLESNFKEHLE 117
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R361 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.