DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5412 and DFR1

DIOPT Version :9

Sequence 1:NP_650895.1 Gene:CG5412 / 42434 FlyBaseID:FBgn0038806 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_014879.1 Gene:DFR1 / 854411 SGDID:S000005762 Length:211 Species:Saccharomyces cerevisiae


Alignment Length:53 Identity:11/53 - (20%)
Similarity:20/53 - (37%) Gaps:6/53 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 IPKEMSESLAARFKNAEVLEHSGGHYFPATAQQKQTFINFFQDRLQEYLEHEE 246
            :|..|:..::..||:..|      |....:..|..:..|...:....:.||.|
Yeast    71 LPNRMNVIISRSFKDDFV------HDKERSIVQSNSLANAIMNLESNFKEHLE 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5412NP_650895.1 FSH1 28..230 CDD:281892 7/35 (20%)
MhpC <177..244 CDD:223669 8/49 (16%)
DFR1NP_014879.1 DHFR 8..208 CDD:238127 11/53 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R361
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.