DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5412 and AT1G09280

DIOPT Version :9

Sequence 1:NP_650895.1 Gene:CG5412 / 42434 FlyBaseID:FBgn0038806 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_563840.1 Gene:AT1G09280 / 837449 AraportID:AT1G09280 Length:581 Species:Arabidopsis thaliana


Alignment Length:236 Identity:78/236 - (33%)
Similarity:115/236 - (48%) Gaps:30/236 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KVRVLCLHGYRQNGEAFKNKLGSFRKFANKYAEFVFITAPHVAKALESAAEP---VPEQRSWWAN 91
            |:|:|||||:|||..:||.:.||..|.....||.|||.|||..:.:...|.|   |..::..|..
plant   353 KLRILCLHGFRQNASSFKGRTGSLAKKLKNIAELVFIDAPHELQFIYQTATPPSGVCNKKFAWLV 417

  Fly    92 KDDGSFKGTNKGG---------------PAFGFQESLRCVEEAWRTQGPFQGLLGFSQGACFVGL 141
            ..|  |...::.|               ...||.:||..::.|:..:|||.|:|||||||.....
plant   418 SSD--FDKPSETGWTVAQCQFDPLQYQTQTEGFDKSLTYLKTAFEEKGPFDGILGFSQGAAMAAA 480

  Fly   142 ICGLAKKKLTSIRPEFAVLASGFLSGSLVHMSAYEEAISIPTLHIYGQ---TDEIIPKEMSESLA 203
            :||..::.:..|...|.||.|||....|:.|.. :.:|..|:|||:|.   .|..|..:.|..||
plant   481 VCGKQEQLVGEIDFRFCVLCSGFTPWPLLEMKE-KRSIKCPSLHIFGSQPGKDRQIVTQASSDLA 544

  Fly   204 ARFKN--AEVLEHSGGHYFPATAQQKQTFINFFQDRLQEYL 242
            ..|::  |.::||..||..|.    |..:|:..:..|.:::
plant   545 GLFEDGCATIVEHDFGHIIPT----KSPYIDEIKAFLYQFI 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5412NP_650895.1 FSH1 28..230 CDD:281892 76/222 (34%)
MhpC <177..244 CDD:223669 21/71 (30%)
AT1G09280NP_563840.1 PRK00142 17..364 CDD:234663 7/10 (70%)
RHOD_YceA 138..251 CDD:238776
Rhodanese_C 261..325 CDD:289163
FSH1 352..573 CDD:281892 77/226 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 115 1.000 Domainoid score I2002
eggNOG 1 0.900 - - E1_KOG2551
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto3491
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48070
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.