DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5412 and AT5G65400

DIOPT Version :9

Sequence 1:NP_650895.1 Gene:CG5412 / 42434 FlyBaseID:FBgn0038806 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001331116.1 Gene:AT5G65400 / 836665 AraportID:AT5G65400 Length:270 Species:Arabidopsis thaliana


Alignment Length:227 Identity:68/227 - (29%)
Similarity:108/227 - (47%) Gaps:26/227 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RVLCLHGYRQNGEAFKNKLGSFRKFANKYAEFVFITAPHVAKALESAAEPV--PEQRSWW-ANKD 93
            |:|||||:|.:|...:..:|.:.....:..:..|:.||..|.. :|..|..  |....|: |||.
plant    49 RILCLHGFRTSGRILQAGIGKWPDTILRDLDLDFLDAPFPATG-KSDVERFFDPPYYEWYQANKG 112

  Fly    94 DGSFKGTNKGGPAFGFQESLRCVEEAWRTQGPFQGLLGFSQGACFVGLICGLAKK--KLTSI-RP 155
            ...::         .|:|.|..:|:.....|||.|||||||||.....|.|:.::  .||.: :.
plant   113 FKEYR---------NFEECLAYIEDYMIKNGPFDGLLGFSQGAFLTAAIPGMQEQGSALTKVPKV 168

  Fly   156 EFAVLASGFLSGSLVH------MSAYEEAISIPTLHIYGQTDEIIPKEMSESLAARFKNAEVLEH 214
            :|.|:.||.....|:.      ::|:...:..|:||..|:.|.:  |...|.|...|....|:.|
plant   169 KFLVIISGAKIPGLMFGEPKAAVNAFSSPVRCPSLHFIGERDFL--KIEGEVLVESFVEPVVIHH 231

  Fly   215 SGGHYFP-ATAQQKQTFINFFQDRLQEYLEHE 245
            ||||..| ...:.::|.::|||. :::.|..|
plant   232 SGGHIIPKLDTKAEETMLSFFQS-IRQMLSDE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5412NP_650895.1 FSH1 28..230 CDD:281892 62/210 (30%)
MhpC <177..244 CDD:223669 21/67 (31%)
AT5G65400NP_001331116.1 FSH1 46..241 CDD:397863 62/203 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2551
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I2346
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1190789at2759
OrthoFinder 1 1.000 - - FOG0002782
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102370
Panther 1 1.100 - - O PTHR48070
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2182
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.