DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5412 and AT4G24380

DIOPT Version :9

Sequence 1:NP_650895.1 Gene:CG5412 / 42434 FlyBaseID:FBgn0038806 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001329756.1 Gene:AT4G24380 / 828540 AraportID:AT4G24380 Length:261 Species:Arabidopsis thaliana


Alignment Length:262 Identity:70/262 - (26%)
Similarity:109/262 - (41%) Gaps:46/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ITEKVRVLCLHGYRQNGEAFKNKLGSFRKFANKYAEFVFITAPHVAKALESAAEPV--PEQRSWW 89
            |..|.|.|||||:|.:||..|.:|..:.|......:.||:.||...:. :|..|.:  |....|:
plant     8 IARKPRFLCLHGFRTSGEIMKIQLHKWPKSVIDRLDLVFLDAPFPCQG-KSDVEGIFDPPYYEWF 71

  Fly    90 A-NKDDGSFKGTNKGGPAFGFQESLRCVEEAWRTQGPFQGLLGFSQGACF------VGLICGLAK 147
            . ||:...:  ||       |::.|..:|:.....|||.||:||||.:..      ..|||.|:.
plant    72 QFNKEFTEY--TN-------FEKCLEYLEDRMIKLGPFDGLIGFSQVSYLHLKLHQQSLICVLSL 127

  Fly   148 KKLTSI------------------------RPEFAVLASGF-LSGSLVHMSAYEEAISIPTLHIY 187
            |.|..|                        :.:|.::..|. |..:.:..:||..::...:||..
plant   128 KTLNLILQGAILSGGLPGLQAKGIAFQKVPKIKFVIIIGGAKLKSAKLAENAYSSSLETLSLHFL 192

  Fly   188 GQTDEIIPKEMSESLAARFKNAEVLEHSGGHYFPATAQQKQTFINFFQDRLQEYLEHEELQQSGN 252
            |:||.:  |.....|...:||..|:.|..||..|...::....:..|.|.|:..:..|:.....|
plant   193 GETDFL--KPYGTQLIESYKNPVVVHHPKGHTVPRLDEKSLEKVTAFIDTLEHLVMEEDKNGEEN 255

  Fly   253 AS 254
            .|
plant   256 TS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5412NP_650895.1 FSH1 28..230 CDD:281892 63/235 (27%)
MhpC <177..244 CDD:223669 17/66 (26%)
AT4G24380NP_001329756.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2551
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I2346
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1190789at2759
OrthoFinder 1 1.000 - - FOG0002782
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR48070
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2182
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.930

Return to query results.
Submit another query.