DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5412 and Ovca2

DIOPT Version :9

Sequence 1:NP_650895.1 Gene:CG5412 / 42434 FlyBaseID:FBgn0038806 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001102506.1 Gene:Ovca2 / 497954 RGDID:1564623 Length:227 Species:Rattus norvegicus


Alignment Length:227 Identity:82/227 - (36%)
Similarity:117/227 - (51%) Gaps:16/227 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EKVRVLCLHGYRQNGEAFKNKLGSFRKFANKYAEFVFITAPH---VAKALESA------AEPVPE 84
            :.:|||||.|:||:...|:.|.|:.||....:||.|.::.||   .|.|.|.|      ..|..:
  Rat     5 QTLRVLCLAGFRQSERGFREKTGALRKALRGHAELVCLSGPHPVTEAAASEGAGTDSGPCSPEEQ 69

  Fly    85 QRSWWANKDDGS-FKGTNKGGPAFGFQESLRCVEEAWRTQGPFQGLLGFSQGACFVGLICGLAKK 148
            .|.||.::::.. |....:.....|.:.:|..|.:|....|||.|||||||||.....:|.|.:.
  Rat    70 PRGWWFSEEEADVFSALEEPTVCRGLEAALETVAQALDKLGPFDGLLGFSQGAALAAFVCALGQA 134

  Fly   149 KLTSI-RPEFAVLASGFLSGSLVHMS-AYEEAISIPTLHIYGQTDEIIPKEMSESLAARFKNAEV 211
            ..... .|.|.:|.|||....|.|.. ..:..||:|:||::|.||.:||.:.|..||:||..|..
  Rat   135 GDPRFPLPRFIILVSGFCPRGLDHKEPILQSPISLPSLHVFGDTDRVIPSQESMQLASRFLGAVT 199

  Fly   212 LEHSGGHYFPATAQQKQTFINFFQDRLQEYLE 243
            |.|||||:.||.|..:|.::.|    |.::.|
  Rat   200 LTHSGGHFIPAAASHRQAYLKF----LDQFAE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5412NP_650895.1 FSH1 28..230 CDD:281892 79/212 (37%)
MhpC <177..244 CDD:223669 29/67 (43%)
Ovca2NP_001102506.1 FSH1 6..218 CDD:281892 79/211 (37%)
MhpC <20..227 CDD:223669 73/210 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H6086
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.