DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5412 and C25G4.2

DIOPT Version :9

Sequence 1:NP_650895.1 Gene:CG5412 / 42434 FlyBaseID:FBgn0038806 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_502376.1 Gene:C25G4.2 / 178194 WormBaseID:WBGene00007730 Length:221 Species:Caenorhabditis elegans


Alignment Length:222 Identity:86/222 - (38%)
Similarity:119/222 - (53%) Gaps:14/222 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KVRVLCLHGYRQNGEAFKNKLGSFRKFANKYAEFVFITAPHVAKALESAAEPVPEQRSWW-ANKD 93
            |:|:||||||||..::|:.|.||.||.....|||.|:...|..    :..|.|...|:|| :|.:
 Worm     6 KLRILCLHGYRQCDQSFRQKTGSTRKLVKSLAEFEFVNGVHSV----AVDEHVDSSRAWWFSNNE 66

  Fly    94 DGSFKGTNKGGPAFGFQESLRCVEEAWRTQGPFQGLLGFSQGACFVGLICG---LAKKKLTSIRP 155
            ..||........|.||:||:..|.:.....|||.|||||||||..|.|:..   |.:.||..|| 
 Worm    67 AMSFSSRESTEVAVGFEESVAAVVKFIEENGPFDGLLGFSQGASMVHLLIAKAQLGEIKLPGIR- 130

  Fly   156 EFAVLASGFLSGSLVHMSAYEEAI-SIPTLHIYGQTDEIIPKEMSESLAARFKNAEVLE--HSGG 217
             ||:..|||||.|..|.|.....| ..|::|::|..|||:.:..||.:|..| :.|.|.  |.||
 Worm   131 -FAIFFSGFLSLSSKHDSLTLLRIKEFPSMHVFGDADEIVARPKSEKMADMF-DVEPLRIAHDGG 193

  Fly   218 HYFPATAQQKQTFINFFQDRLQEYLEH 244
            |..|:.::.|:....|.:::|...:|:
 Worm   194 HVVPSMSKHKEKIAGFMREQLDRKIEN 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5412NP_650895.1 FSH1 28..230 CDD:281892 83/206 (40%)
MhpC <177..244 CDD:223669 21/69 (30%)
C25G4.2NP_502376.1 FSH1 1..206 CDD:281892 83/206 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161927
Domainoid 1 1.000 131 1.000 Domainoid score I3225
eggNOG 1 0.900 - - E1_KOG2551
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6086
Inparanoid 1 1.050 138 1.000 Inparanoid score I3110
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53056
OrthoDB 1 1.010 - - D1190789at2759
OrthoFinder 1 1.000 - - FOG0002782
OrthoInspector 1 1.000 - - oto20534
orthoMCL 1 0.900 - - OOG6_102370
Panther 1 1.100 - - LDO PTHR48070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R361
SonicParanoid 1 1.000 - - X2182
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.