DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5412 and OVCA2

DIOPT Version :9

Sequence 1:NP_650895.1 Gene:CG5412 / 42434 FlyBaseID:FBgn0038806 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_543012.1 Gene:OVCA2 / 124641 HGNCID:24203 Length:227 Species:Homo sapiens


Alignment Length:225 Identity:81/225 - (36%)
Similarity:118/225 - (52%) Gaps:16/225 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VRVLCLHGYRQNGEAFKNKLGSFRKFANKYAEFVFITAPHV---------AKALESAAEPVPEQR 86
            :|||||.|:||:...|:.|.|:.||.....||.|.::.||.         |::...:..|..:.|
Human     7 LRVLCLAGFRQSERGFREKTGALRKALRGRAELVCLSGPHPVPDPPGPEGARSDFGSCPPEEQPR 71

  Fly    87 SWWANKDDGS-FKGTNKGGPAFGFQESLRCVEEAWRTQGPFQGLLGFSQGACFVGLICGLAKKKL 150
            .||.::.:.. |....:.....|.:|||..|.:|....|||.|||||||||....|:|.|.:...
Human    72 GWWFSEQEADVFSALEEPAVCRGLEESLGMVAQALNRLGPFDGLLGFSQGAALAALVCALGQAGD 136

  Fly   151 TSI-RPEFAVLASGFL-SGSLVHMSAYEEAISIPTLHIYGQTDEIIPKEMSESLAARFKNAEVLE 213
            ... .|.|.:|.|||. .|.....|..:..:|:|:||::|.||::||.:.|..||::|..|..|.
Human   137 PRFPLPRFILLVSGFCPRGIGFKESILQRPLSLPSLHVFGDTDKVIPSQESVQLASQFPGAITLT 201

  Fly   214 HSGGHYFPATAQQKQTFINFFQDRLQEYLE 243
            |||||:.||.|.|:|.::.|    |.::.|
Human   202 HSGGHFIPAAAPQRQAYLKF----LDQFAE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5412NP_650895.1 FSH1 28..230 CDD:281892 78/210 (37%)
MhpC <177..244 CDD:223669 28/67 (42%)
OVCA2NP_543012.1 FSH1 5..218 CDD:309182 78/210 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..68 4/23 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151374
Domainoid 1 1.000 137 1.000 Domainoid score I4912
eggNOG 1 0.900 - - E1_KOG2551
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6086
Inparanoid 1 1.050 141 1.000 Inparanoid score I4492
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53056
OrthoDB 1 1.010 - - D1190789at2759
OrthoFinder 1 1.000 - - FOG0002782
OrthoInspector 1 1.000 - - oto89021
orthoMCL 1 0.900 - - OOG6_102370
Panther 1 1.100 - - LDO PTHR48070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R361
SonicParanoid 1 1.000 - - X2182
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.