DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and TOX

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_055544.1 Gene:TOX / 9760 HGNCID:18988 Length:526 Species:Homo sapiens


Alignment Length:139 Identity:32/139 - (23%)
Similarity:64/139 - (46%) Gaps:15/139 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DPSRANDTDHRPLTPPRPLAAASISNTPAVPSKTLEEQLGLPPRPKKPLTPYFRFMREQRPKLKA 98
            |.|:.|..:.||        |:.:...|..|.|..::.   |..|:||::.|..|.|:.:..:|.
Human   228 DTSKINGGEKRP--------ASDMGKKPKTPKKKKKKD---PNEPQKPVSAYALFFRDTQAAIKG 281

  Fly    99 ANPQITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIYVEERTKYDATLTEEQRAEIKQLK-- 161
            .||..|..||.:.::..|.....:.|:..:.:.:..::.|:::...|.|:|..:..:|...:|  
Human   282 QNPNATFGEVSKIVASMWDGLGEEQKQVYKKKTEAAKKEYLKQLAAYRASLVSKSYSEPVDVKTS 346

  Fly   162 --QDLVDAK 168
              ..|:::|
Human   347 QPPQLINSK 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 15/63 (24%)
HMGB-UBF_HMG-box 183..247 CDD:238686
TOXNP_055544.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..178
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..264 11/46 (24%)
Nuclear localization signal. /evidence=ECO:0000255 237..256 6/26 (23%)
NHP6B <257..>360 CDD:227935 23/102 (23%)
HMG-box 261..>310 CDD:238037 14/48 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.