DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and NHP6A

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_015377.1 Gene:NHP6A / 856165 SGDID:S000006256 Length:93 Species:Saccharomyces cerevisiae


Alignment Length:90 Identity:28/90 - (31%)
Similarity:47/90 - (52%) Gaps:0/90 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 TPAVPSKTLEEQLGLPPRPKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQLK 124
            ||..|.|....:...|..||:.|:.|..|..|.|..:::.||.||..:|.::|.:.|.....:.|
Yeast     3 TPREPKKRTTRKKKDPNAPKRALSAYMFFANENRDIVRSENPDITFGQVGKKLGEKWKALTPEEK 67

  Fly   125 ERLQAEFKRDQQIYVEERTKYDATL 149
            :..:|:.:.|::.|..|:..|:|||
Yeast    68 QPYEAKAQADKKRYESEKELYNATL 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 18/63 (29%)
HMGB-UBF_HMG-box 183..247 CDD:238686
NHP6ANP_015377.1 NHP6B <1..>93 CDD:227935 28/90 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.