DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and ABF2

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_013788.1 Gene:ABF2 / 855094 SGDID:S000004676 Length:183 Species:Saccharomyces cerevisiae


Alignment Length:173 Identity:41/173 - (23%)
Similarity:71/173 - (41%) Gaps:47/173 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 PKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIYVEER 142
            ||:|.:.||.::::.|.:....||.:...|:.:...:.|.:.:|.:||:           |:.||
Yeast    43 PKRPTSAYFLYLQDHRSQFVKENPTLRPAEISKIAGEKWQNLEADIKEK-----------YISER 96

  Fly   143 TKYDATLTEEQRAEIKQLKQDLVDAKERRQLRKRVKELGRPKKPASAFLRFIASERINTPQGDKQ 207
            .|   ..:|.|:|                  :|...|...|||||..|:::....|       .|
Yeast    97 KK---LYSEYQKA------------------KKEFDEKLPPKKPAGPFIKYANEVR-------SQ 133

  Fly   208 TYREWHQKTTA--------KWTRLSDSEKEVYMQESRKEMELY 242
            .:.:...|:..        ||..|..|.|:.|:||.:|.::.|
Yeast   134 VFAQHPDKSQLDLMKIIGDKWQSLDQSIKDKYIQEYKKAIQEY 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 14/63 (22%)
HMGB-UBF_HMG-box 183..247 CDD:238686 19/68 (28%)
ABF2NP_013788.1 NHP6B 1..183 CDD:227935 41/173 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.