DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and IXR1

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_012893.3 Gene:IXR1 / 853836 SGDID:S000001515 Length:597 Species:Saccharomyces cerevisiae


Alignment Length:221 Identity:52/221 - (23%)
Similarity:98/221 - (44%) Gaps:45/221 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DPSRANDTDHRPLTPPRPLAAASISNTPAVPSKTLEEQLGLPPRPKKPLTPYFRFMREQRPKLKA 98
            |||.|.:             ||..:||...|..       |||..:..||.:.:.|::|      
Yeast   256 DPSSAGN-------------AAGNANTATHPGL-------LPPNLQPQLTHHQQQMQQQ------ 294

  Fly    99 ANPQITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIYVEERTKYDATLTEEQRAEIKQLKQD 163
                 ..::..:||         |.:::||.:.:..||..::::..:   |.::|:.:...:.:.
Yeast   295 -----LQLQQQQQL---------QQQQQLQQQHQLQQQQQLQQQHHH---LQQQQQQQQHPVVKK 342

  Fly   164 LVDAKERRQLRKRVKELGRPKKPASAFLRFIASERIN-TPQGDKQTYREWHQKTTAKWTRLSDSE 227
            |...:.|.:.||::|:.| ||:|:||:..|..|.|.. ..|..:....|..:..:|:|..|:|.:
Yeast   343 LSSTQSRIERRKQLKKQG-PKRPSSAYFLFSMSIRNELLQQFPEAKVPELSKLASARWKELTDDQ 406

  Fly   228 KEVYMQESRKEMELYRKAISVWEEKM 253
            |:.:.:|.|...|.||.....:|:.:
Yeast   407 KKPFYEEFRTNWEKYRVVRDAYEKTL 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 11/63 (17%)
HMGB-UBF_HMG-box 183..247 CDD:238686 20/64 (31%)
IXR1NP_012893.3 NHP6B <338..501 CDD:227935 27/96 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.