DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and HMO1

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_010459.1 Gene:HMO1 / 851754 SGDID:S000002581 Length:246 Species:Saccharomyces cerevisiae


Alignment Length:92 Identity:27/92 - (29%)
Similarity:48/92 - (52%) Gaps:10/92 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 AVPSKTLEEQLGLPPR-PKKPLTPYFRF-------MREQRPKLKAANPQITTVEVVRQLSKNWSD 118
            |.|.|.:..::...|. ||||||.:|.:       :||.|.  ||..|.:::.|:.:::||.|.:
Yeast    89 AAPVKAVRRKIERDPNAPKKPLTVFFAYSAYVRQELREDRQ--KAGLPPLSSTEITQEISKKWKE 151

  Fly   119 ADAQLKERLQAEFKRDQQIYVEERTKY 145
            .....||:.:..:..:.:.|..|::||
Yeast   152 LSDNEKEKWKQAYNVELENYQREKSKY 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 20/70 (29%)
HMGB-UBF_HMG-box 183..247 CDD:238686
HMO1NP_010459.1 NHP6B 36..246 CDD:227935 27/92 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.