DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and HMGB3

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001031075.1 Gene:HMGB3 / 838659 AraportID:AT1G20696 Length:147 Species:Arabidopsis thaliana


Alignment Length:113 Identity:32/113 - (28%)
Similarity:53/113 - (46%) Gaps:19/113 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 EQRAEIKQLKQDLVDAKERRQLRKRVKELGRPKKPASAFLRFIASERINTPQGDKQTYREWHQKT 216
            :.:||.:..|.. |..|..:..:...|:..:||:|:|||..|:...|:        ||:|.|.|.
plant     5 KSKAETRSTKLS-VTKKPAKGAKGAAKDPNKPKRPSSAFFVFMEDFRV--------TYKEEHPKN 60

  Fly   217 TA----------KWTRLSDSEKEVYMQESRKEMELYRKAISVWEEKMI 254
            .:          ||..||||||..|:.::.|....|.|.:..:.:|::
plant    61 KSVAAVGKAGGEKWKSLSDSEKAPYVAKADKRKVEYEKNMKAYNKKLV 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686
HMGB-UBF_HMG-box 183..247 CDD:238686 25/73 (34%)
HMGB3NP_001031075.1 HMGB-UBF_HMG-box 35..101 CDD:238686 25/73 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.