DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and HMGB5

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001329802.1 Gene:HMGB5 / 829709 AraportID:AT4G35570 Length:125 Species:Arabidopsis thaliana


Alignment Length:105 Identity:29/105 - (27%)
Similarity:48/105 - (45%) Gaps:19/105 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 NTPAVPSKTLEEQLGL-----------PPRPKKPLTPYFRFMREQRPKLKAANPQITTV-EVVRQ 111
            |...|.|::.:::|.:           |.|||||.:|:|.|:.:.|.:...|||...:| .|.|.
plant     4 NQTEVESRSTDDRLKVRGNKVGKKTKDPNRPKKPPSPFFVFLDDFRKEFNLANPDNKSVGNVGRA 68

  Fly   112 LSKNWSDADAQLKERLQAEFKRDQQIYVEERTKYDATLTE 151
            ..|.|.    .:.|..:|.|....|   .::|:|..|:.:
plant    69 AGKKWK----TMTEEERAPFVAKSQ---SKKTEYAVTMQQ 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 20/64 (31%)
HMGB-UBF_HMG-box 183..247 CDD:238686
HMGB5NP_001329802.1 HMGB-UBF_HMG-box 34..100 CDD:238686 23/72 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.