DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and 3xHMG-box2

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_194111.1 Gene:3xHMG-box2 / 828480 AraportID:AT4G23800 Length:456 Species:Arabidopsis thaliana


Alignment Length:203 Identity:53/203 - (26%)
Similarity:95/203 - (46%) Gaps:30/203 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 PPRPKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIYV 139
            |.:||.|::.:..:..|:|..|:..|..:  |||.:...:.|.:...:.|...:...|::::.|:
plant   252 PLKPKHPVSAFLVYANERRAALREENKSV--VEVAKITGEEWKNLSDKKKAPYEKVAKKNKETYL 314

  Fly   140 EERTKYDATLTEE---QRAEIKQL----------------KQDLVDAKERRQLRKRVKEL--GRP 183
            :...:|..|..||   |:.|.::|                |.|.:..||:...:|:.:.:  .:|
plant   315 QAMEEYKRTKEEEALSQKKEEEELLKLHKQEALQMLKKKEKTDNLIKKEKATKKKKNENVDPNKP 379

  Fly   184 KKPASAFLRFIASERINTPQGDKQTYREWHQKTTA----KWTRLSDSEKEVYMQESRKEMELYRK 244
            |||||::..|...||....:....|.   :...||    ||..||:.||:||..::.|.||.|:|
plant   380 KKPASSYFLFSKDERKKLTEERPGTN---NATVTALISLKWKELSEEEKQVYNGKAAKLMEAYKK 441

  Fly   245 AISVWEEK 252
            .:..:.:|
plant   442 EVEAYNKK 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 14/63 (22%)
HMGB-UBF_HMG-box 183..247 CDD:238686 25/67 (37%)
3xHMG-box2NP_194111.1 PTZ00121 <2..454 CDD:173412 53/203 (26%)
HMGB-UBF_HMG-box 139..203 CDD:238686
HMG-box 255..320 CDD:381793 14/66 (21%)
HMGB-UBF_HMG-box 379..444 CDD:238686 25/67 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.