DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and 3xHMG-box1

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_192846.1 Gene:3xHMG-box1 / 826709 AraportID:AT4G11080 Length:446 Species:Arabidopsis thaliana


Alignment Length:208 Identity:53/208 - (25%)
Similarity:96/208 - (46%) Gaps:40/208 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 PPRPKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIYV 139
            |.:||:|::.|..:..|:|..||..|..:  :||.:...:.|.:...:.|.......|::::||:
plant   243 PLKPKQPISAYLIYANERRAALKGENKSV--IEVAKMAGEEWKNLSEEKKAPYDQMAKKNKEIYL 305

  Fly   140 EE-----RTKYDATLTEEQRAE--IKQLKQD---LVDAKERR-QLRKRVKEL------------G 181
            :|     |||.:..:::::..|  :|..||:   |:..||:. .:.|:.||.            .
plant   306 QEMEGYKRTKEEEAMSQKKEEEEFMKLHKQEALQLLKKKEKTDNIIKKTKETAKNKKKNENVDPN 370

  Fly   182 RPKKPASAFLRFIASERINTPQGDKQTYREW----HQKTTA----KWTRLSDSEKEVYMQESRKE 238
            :||||.|::..|....|       |....|.    :...||    ||..|.:.||:||..::.:.
plant   371 KPKKPTSSYFLFCKDAR-------KSVLEEHPGINNSTVTAHISLKWMELGEEEKQVYNSKAAEL 428

  Fly   239 MELYRKAISVWEE 251
            ||.|:|.:..:.:
plant   429 MEAYKKEVEEYNK 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 17/68 (25%)
HMGB-UBF_HMG-box 183..247 CDD:238686 22/71 (31%)
3xHMG-box1NP_192846.1 HMGB-UBF_HMG-box 130..193 CDD:238686
HMGB-UBF_HMG-box 246..309 CDD:238686 17/64 (27%)
HMGB-UBF_HMG-box 372..437 CDD:238686 22/71 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.