DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and hmgb1b

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001092721.2 Gene:hmgb1b / 795095 ZFINID:ZDB-GENE-030131-8480 Length:197 Species:Danio rerio


Alignment Length:189 Identity:43/189 - (22%)
Similarity:74/189 - (39%) Gaps:36/189 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 PPRPKKPLTPYFRFMREQRPKLKAANPQ--ITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQI 137
            |.:|:..::.|..|::..|.:.|..:|:  :...|..::.|:.|....|:.|.:.:...|:|:..
Zfish     5 PRKPRGKMSSYAYFVQTCREEHKKKHPEASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKQDKVR 69

  Fly   138 YVEERTKYDATLTEEQRAEIKQLKQDLVDAKERRQLRKRVKELGRPKKPASAFLRF-------IA 195
            |..|...|                     ...:.:.:||.|:...||:|.|||..|       |.
Zfish    70 YEREMKNY---------------------IPPKGEKKKRFKDPNAPKRPPSAFFIFCGDYRPKIK 113

  Fly   196 SERINTPQGDKQTYREWHQKTTAKWTRLSDSEKEVYMQESRKEMELYRKAISVWEEKMI 254
            .|......||..      :|....|...|...|:.|.:::.|..|.|.|.|:::..|.|
Zfish   114 GENPGLSIGDIA------KKLGEMWNSSSAEVKQPYEKKAAKLKEKYDKDIALYRTKGI 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 14/65 (22%)
HMGB-UBF_HMG-box 183..247 CDD:238686 20/70 (29%)
hmgb1bNP_001092721.2 HMG_box_2 6..77 CDD:286146 15/70 (21%)
HMG_box 94..161 CDD:278906 21/72 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.