DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and Hmgb4

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_081312.2 Gene:Hmgb4 / 69317 MGIID:1916567 Length:181 Species:Mus musculus


Alignment Length:189 Identity:51/189 - (26%)
Similarity:78/189 - (41%) Gaps:45/189 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 EEQLGLPPRPKKPLTPYFRFMREQRPKLKAANPQ--ITTVEVVRQLSKNWSDADAQLKERLQAEF 131
            ::||    |||..::.|..||...|.|.|...|.  :...|..|:.|:.|               
Mouse     4 KDQL----RPKVNVSSYIHFMLNFRNKFKEQQPNTYLGFKEFSRKCSEKW--------------- 49

  Fly   132 KRDQQIYVEERTKYDATLTEEQRAEIKQLKQDLVDAKERRQLRKRVKELGRPKKPASAFLRFIAS 196
               :.|...|:.||:| |.|..:|..:|...:.:.  :||:.|||  :...|:||.|:||.|...
Mouse    50 ---RSISKHEKAKYEA-LAELDKARYQQEMMNYIG--KRRKRRKR--DPKAPRKPPSSFLLFSRD 106

  Fly   197 ERINTPQGDKQTYREWHQKTTAK-----WTRLSDSEKEVYMQESR-------KEMELYR 243
            .....    ||...:|.....||     |:...::||:.|.|::.       :|.|.||
Mouse   107 HYAML----KQENPDWTVVQVAKAAGKMWSTTDEAEKKPYEQKAALMRAKYFEEQEAYR 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 14/65 (22%)
HMGB-UBF_HMG-box 183..247 CDD:238686 21/73 (29%)
Hmgb4NP_081312.2 HMG-box 8..78 CDD:294061 23/88 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..100 9/23 (39%)
HMG-box 93..156 CDD:238037 17/66 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.