DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and LOC688702

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006257650.1 Gene:LOC688702 / 688702 RGDID:1585304 Length:168 Species:Rattus norvegicus


Alignment Length:187 Identity:48/187 - (25%)
Similarity:72/187 - (38%) Gaps:55/187 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 RPKKPLTPYFRFM-------REQRPKLKAANPQITTVEVVRQLSKNWSDADAQLKERLQAEFKRD 134
            |||..::||..||       |||:|     |......|..|:.|:.|.....:.|::.:|..|||
  Rat     8 RPKVNVSPYVHFMMDFRNQTREQQP-----NTYYDFTEFSRKCSEKWRTISKKEKKKYEALAKRD 67

  Fly   135 QQIYVEERTKYDATLTEEQRAEIKQLKQDLVDAKERRQLRKRVKELGRPKKPASAFLRFIAS--E 197
            :..|..|...|..                     .||:.|:|  :...|:||.|:||.|...  :
  Rat    68 KDRYQREMRNYSG---------------------PRRERRRR--DPDAPRKPPSSFLLFSQDHFD 109

  Fly   198 RINTPQGDKQTYREWHQKTTAK-----WTRLSDSEKEVYMQESR-------KEMELY 242
            .|      |:.:..|.....||     |.|.|:::|..|.:.:.       :|.|.|
  Rat   110 EI------KEQHPNWTVAQVAKAAGRMWARCSEADKIPYEERAAVLRAKYLEEREAY 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 21/70 (30%)
HMGB-UBF_HMG-box 183..247 CDD:238686 20/74 (27%)
LOC688702XP_006257650.1 HMGB-UBF_HMG-box 9..76 CDD:238686 22/71 (31%)
HMGB-UBF_HMG-box 95..158 CDD:238686 17/68 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.