DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and LOC681067

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006257578.1 Gene:LOC681067 / 681067 RGDID:1584677 Length:168 Species:Rattus norvegicus


Alignment Length:182 Identity:47/182 - (25%)
Similarity:73/182 - (40%) Gaps:45/182 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 RPKKPLTPYFRFMREQRPKLKAANPQI--TTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIYV 139
            |||..::||..||.:.|.:::...|.|  ...|..|:.|:.|.....:.|::.:|..|||:..|.
  Rat     8 RPKVNVSPYVHFMMDFRNQMREQQPNIYYDFTEFSRKCSEKWKTISKKEKKKYEALAKRDKDRYQ 72

  Fly   140 EERTKYDATLTEEQRAEIKQLKQDLVDAKERRQLRKRVKELGRPKKPASAFLRFIAS--ERINTP 202
            .|...|..                     .||:.|:|  :...|:||.|:||.|...  |.|   
  Rat    73 REMRNYSG---------------------PRRERRRR--DADAPRKPPSSFLLFSQDHFEEI--- 111

  Fly   203 QGDKQTYREWHQKTTAK-----WTRLSDSEKEVYMQESR-------KEMELY 242
               |:.:..|.....||     |.|.|:::|..|.:.:.       :|.|.|
  Rat   112 ---KEQHPNWTVGQVAKAAGRMWARCSEADKIPYEERAAVLRAKYLEEREAY 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 19/65 (29%)
HMGB-UBF_HMG-box 183..247 CDD:238686 21/74 (28%)
LOC681067XP_006257578.1 HMGB-UBF_HMG-box 9..76 CDD:238686 20/66 (30%)
HMGB-UBF_HMG-box 95..158 CDD:238686 18/68 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.