DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and BBX

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_024309412.1 Gene:BBX / 56987 HGNCID:14422 Length:953 Species:Homo sapiens


Alignment Length:316 Identity:64/316 - (20%)
Similarity:105/316 - (33%) Gaps:77/316 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KDWP-PSDPSRANDTDHRPLTPPRP-------------------LAAASISNTPAVPSKTLEEQL 72
            |.|. |||.||...:..:..|...|                   ||......||.|.|.|....:
Human   181 KLWAFPSDSSRDLPSPKKAKTEEMPQLNFGMADPTQMGGLSMLLLAGEHALGTPEVSSGTCRPDV 245

  Fly    73 GLPP--RPKKPLTPYFRFMR--------------------EQRPKLKAANPQITTVEVVRQLSKN 115
            ...|  |.|.||   |:|..                    .|..::.:...|:...|.|::..|:
Human   246 SESPELRQKSPL---FQFAEISSSTSHSDASTKQCQTSALFQFAEISSNTSQLGGAEPVKRCGKS 307

  Fly   116 WSDADAQLKERLQAE--FKRDQQIYVEERTKYDATLTE----EQRAEIKQLKQDLVDAKERRQLR 174
               |..||.|...|.  .|.::...::.:......:.|    ::..|||..|.|....::..:..
Human   308 ---ALFQLAEMCLASEGMKMEESKLIKAKESDGGRIKELEKGKEEKEIKMEKTDETRLQKEAEFE 369

  Fly   175 KRVKELGRPKKPASAFLRFIASERINTPQGDKQTYREWHQKTTAKWTRLSD----SEKEVYMQE- 234
            |..||..|..|....|......:.:.....|.:..|:...:...|.:...|    :..::.:.: 
Human   370 KSAKENLRDSKELRNFEALQIDDIMAIKMEDPKEIRKEELEEDHKCSHFPDFSYSASSKIIISDV 434

  Fly   235 -SRKEMELYRKAISVWEE-----------KMIRLGHIDVVRHGNLIDPPEPKPRKT 278
             |||:...:...|.:.|:           |..:...:|  ||||    .:..|:||
Human   435 PSRKDHMCHPHGIMIIEDPAALNKPEKLKKKKKKSKMD--RHGN----DKSTPKKT 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 16/85 (19%)
HMGB-UBF_HMG-box 183..247 CDD:238686 9/69 (13%)
BBXXP_024309412.1 SOX-TCF_HMG-box 91..162 CDD:238684
DUF2028 203..>335 CDD:312980 26/137 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.