DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and hmgb3a

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001116308.1 Gene:hmgb3a / 561025 ZFINID:ZDB-GENE-050428-1 Length:213 Species:Danio rerio


Alignment Length:226 Identity:48/226 - (21%)
Similarity:93/226 - (41%) Gaps:50/226 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GLPPRPKKPLTPYFRFMREQRPKLKAANPQI--TTVEVVRQLSKNWSDADAQLKERLQAEFKRDQ 135
            |.|.:||..::.|..|::..|.:.|..:|:|  :..|..::.|..|.....:.|.|.:...|:|:
Zfish     4 GDPRKPKGKMSAYAYFVQTCREEHKKKSPEIPVSFSEFSKRCSGRWKAMTDKEKSRFEDMAKQDK 68

  Fly   136 QIYVEERTKYDATLTEEQRAEIKQLKQDLVDAKERRQLRKRVKELGRPKKPASAFLRFIASERIN 200
            ..|.:|...|                   :..|     |.:.|:...||:|.|.|..|.:..|  
Zfish    69 VRYDQEMMHY-------------------MPGK-----RGKKKDPNAPKRPPSGFFLFCSEHR-- 107

  Fly   201 TPQ----------GDKQTYREWHQKTTAKWTRLSDSEKEVYMQESRKEMELYRKAISVWEEKMIR 255
             ||          ||..      :|....|..|:|:.|:.::.::.|..:.|:|.::.::.|. :
Zfish   108 -PQIKAQYPSLGIGDVA------KKLGEMWNGLTDANKQPFLMKANKLKDKYQKDVADYKTKS-K 164

  Fly   256 LGHIDV---VRHGNLIDPPEPKPRKTLASKD 283
            .|.:.:   :...|.: ||:|..:..:..::
Zfish   165 AGGVSMGMGMPMANCM-PPKPMMKSNMDDEE 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 16/65 (25%)
HMGB-UBF_HMG-box 183..247 CDD:238686 19/73 (26%)
hmgb3aNP_001116308.1 HMG_box_2 7..78 CDD:286146 17/70 (24%)
HMG_box 92..159 CDD:278906 19/75 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.