DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and tox4a

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_001921001.2 Gene:tox4a / 559853 ZFINID:ZDB-GENE-070912-576 Length:685 Species:Danio rerio


Alignment Length:166 Identity:36/166 - (21%)
Similarity:71/166 - (42%) Gaps:18/166 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TTLMSSRGGLIGSLINKVRQ--VVAKDWPPSDPSRANDTDHRPLTPPRPLAAASISNTPAVPSKT 67
            :|..|..|.|....:...||  ::...:..|:||.|.      ::.|.|:..........||..|
Zfish   221 STTPSPSGSLQDEDMEDFRQKTMLVDSFAVSEPSPAQ------ISVPPPVVRRVGGKPSMVPVAT 279

  Fly    68 LE--EQLGL--------PPRPKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQ 122
            ::  ..||:        |..|:||::.|..|.|:.:..:|..||..|..||.:.::..|.....:
Zfish   280 VDTGASLGVKKGKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEE 344

  Fly   123 LKERLQAEFKRDQQIYVEERTKYDATLTEEQRAEIK 158
            .|:..:.:.:..::.|::....|.|:...:..:|::
Zfish   345 QKQVYKRKTEAAKKDYLKALAAYRASQLSKSSSELE 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 15/63 (24%)
HMGB-UBF_HMG-box 183..247 CDD:238686
tox4aXP_001921001.2 PHA03369 <215..510 CDD:223061 36/166 (22%)
HMG-box 300..365 CDD:238037 15/64 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.