DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and sox13

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001352418.1 Gene:sox13 / 555983 ZFINID:ZDB-GENE-100519-1 Length:597 Species:Danio rerio


Alignment Length:289 Identity:61/289 - (21%)
Similarity:101/289 - (34%) Gaps:94/289 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PRPLAAASISNTPAVPSKTLEEQLGLP--PRPKKPLTPYFRFMREQRPKLKAANPQITTVE---- 107
            |..:..|...|...:| .|.|.|:|||  |.|.||:         :.|.....||..|.|:    
Zfish   222 PYVMIPAFHPNAQPLP-VTSEAQMGLPLQPIPCKPV---------EYPMQLLPNPHSTPVKRSSG 276

  Fly   108 -VVRQLSKNWSDADAQLK---------ERLQAEFK-RD----------------------QQIYV 139
             |.||.:....:..|:.|         ..||:.:: ||                      |.|:.
Zfish   277 TVYRQDTSQPLNLTAKPKTPSPQALELAHLQSGYRHRDLPQSPPRSALSLSFLGEGDVVTQAIHD 341

  Fly   140 EE-----------RTKYDATLTEEQRAEI----KQLKQDLVDAKERRQL---------RKRVKEL 180
            .:           |.:.:.|..|..|..:    .:..:|...:....|:         ..|....
Zfish   342 AQQLLRGGQSSTGRERDNNTRLEASRDRMDDGHSRTNEDHHSSDSEGQMAISGVGSFGESRTPSS 406

  Fly   181 GRPKKPASAFLRFIASERINTPQGDKQTYREWHQKTTAK-----WTRLSDSEKEVYMQE----SR 236
            |..|:|.:||:.:...||    :...|.:.:.|..:.:|     |..:|:.||:.|.:|    ||
Zfish   407 GHIKRPMNAFMVWAKDER----RRILQAFPDMHNSSISKILGSRWKSMSNQEKQPYYEEQARLSR 467

  Fly   237 KEMELY--------RKAISVWEEKMIRLG 257
            :.:|.|        .|...:.|.:.:|:|
Zfish   468 QHLERYPDYKYKPRPKRTCIVEGRRLRVG 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 19/111 (17%)
HMGB-UBF_HMG-box 183..247 CDD:238686 20/80 (25%)
sox13NP_001352418.1 SOX-TCF_HMG-box 408..479 CDD:238684 19/74 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.