DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and Ubtfl1

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001028965.1 Gene:Ubtfl1 / 546118 MGIID:3588290 Length:394 Species:Mus musculus


Alignment Length:209 Identity:48/209 - (22%)
Similarity:106/209 - (50%) Gaps:25/209 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 SKTLEEQLGLPPRPKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQLKERLQA 129
            :|.|.|.   |.|||:|||.|.||.:|||.|.....|:.:..::.:.|::.:....|::|:|...
Mouse    91 NKILTEH---PDRPKRPLTAYLRFYKEQRAKYCQMYPKYSNAQLTKILAEKYRQLPAEIKQRYIM 152

  Fly   130 EFKRDQQIYVEERTKY-------------------DATLTEEQRAEIKQLKQDLVDAKERRQLRK 175
            :||::::.:.::..::                   ...:..:.:.:||.:| .||..:..|.:..
Mouse   153 DFKKEKEDFQKKMRQFKKRHPVSGHPKKSVVPQSHPTKVPTKSQGDIKNVK-SLVKTESPRTVSS 216

  Fly   176 RVKELGRPKK-PASAFLRFIASERINTPQGDKQTYREWHQKTTAKWTRLSDSEKEVYMQESRKEM 239
            .:|..|.|:| |.:|:.:| ..|..::|:....::|:...:.:.:|.::.::|||.|..:.::..
Mouse   217 DMKFQGEPRKPPMNAYHKF-HQESWSSPELRHLSFRKRWVEISRRWHQVPENEKEHYSNQVKRLQ 280

  Fly   240 ELYRKAISVWEEKM 253
            :.||..:.:|.:::
Mouse   281 KQYRVKLDLWLKRL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 19/63 (30%)
HMGB-UBF_HMG-box 183..247 CDD:238686 15/64 (23%)
Ubtfl1NP_001028965.1 HMGB-UBF_HMG-box 101..166 CDD:238686 19/64 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..197 0/29 (0%)
HMGB-UBF_HMG-box 226..288 CDD:238686 14/62 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.