DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and Hmgb2l1

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001316810.1 Gene:Hmgb2l1 / 498072 RGDID:1564519 Length:210 Species:Rattus norvegicus


Alignment Length:219 Identity:54/219 - (24%)
Similarity:84/219 - (38%) Gaps:54/219 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GLPPRPKKPLTPYFRFMREQRPKLKAANP--QITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQ 135
            |.|.:|:..::.|..|::..|.:.|..:|  .:...|..::.|:.|....|:.|.:.:...|.|:
  Rat     4 GDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDLAKSDK 68

  Fly   136 QIYVEERTKYDATLTEEQRAEIKQLKQDLVDAKERRQLRKRVKELGRPKKPASAFLRF------- 193
            ..|..|...|                   |..|..::.:|  |:...||:|.|||..|       
  Rat    69 ARYDREMKNY-------------------VPPKGDKKGKK--KDPNAPKRPPSAFFLFCSEHRPK 112

  Fly   194 IASERINTPQGDKQTYREWHQKTTAK-----WTRLSDSEKEVYMQESRKEMELYRKAISVWEEKM 253
            |.||......||           |||     |:..|..:|:.|.|::.|..|.|.|.|:.:..| 
  Rat   113 IKSEHPGLSIGD-----------TAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAK- 165

  Fly   254 IRLGHIDVVRHGNLIDPPEPKPRK 277
               |..:|.:.|    |..|...|
  Rat   166 ---GKSEVGKKG----PGRPTGSK 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 14/65 (22%)
HMGB-UBF_HMG-box 183..247 CDD:238686 24/75 (32%)
Hmgb2l1NP_001316810.1 HMG_box_2 6..78 CDD:401091 16/71 (23%)
HMG_box 95..162 CDD:395407 25/77 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.