DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and AgaP_AGAP011323

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_001237213.1 Gene:AgaP_AGAP011323 / 4577567 VectorBaseID:AGAP011323 Length:100 Species:Anopheles gambiae


Alignment Length:98 Identity:22/98 - (22%)
Similarity:37/98 - (37%) Gaps:16/98 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 GRPKKPASAFLRFIASERINTPQGDKQTYRE----WHQKTTAKWTRLSDSEKEVYMQESRKEMEL 241
            |:|.|..||.....:..|...|....:.||.    .|:|..|   ....:|:.|:.....::|..
Mosquito     4 GKPVKSHSAIASSESKPRERAPLDTNEAYRRGVKLLHEKCKA---LQRSNERLVFRLHRVQKMTR 65

  Fly   242 YR-KAISVWEEKMIRLGH--------IDVVRHG 265
            .| :.:.:.:.|:..||.        :||...|
Mosquito    66 SRARDVEILKAKLDSLGDEWRTAPDPMDVKEEG 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686
HMGB-UBF_HMG-box 183..247 CDD:238686 15/68 (22%)
AgaP_AGAP011323XP_001237213.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.