DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and jigr1

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster


Alignment Length:161 Identity:27/161 - (16%)
Similarity:64/161 - (39%) Gaps:34/161 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 RPKLKAANPQITTVEVVRQLSKN---WSDADAQLKERLQAEFKRDQQIYVEERTKYDATLTEEQ- 153
            ||:...|......:.::|:...:   :..::.:.|::|......:|   :..:..||||...|: 
  Fly    18 RPRATYAQTGEFDLGLIREYRSHPVLYDRSNKRFKDKLYVAHIWEQ---IAHKLGYDATSIRERM 79

  Fly   154 -------RAEIKQLKQDLVDAKERRQLRKRVKELGRPKKPASAFLRFIASERINTPQGDKQTYRE 211
                   ..|.::::..|.....:..|.:.::.||...:|..:|      :.::..:.|::||  
  Fly    80 TTLRNRYNIEKRRVENGLSTQSSQWPLFESLQFLGDHIRPRRSF------KNMSVKEEDEETY-- 136

  Fly   212 WHQKTTAKWTRLSD--SEKEVYMQESRKEME 240
                      .:.|  |:...:|...:.|:|
  Fly   137 ----------EVDDCRSDSNGHMNSIKDELE 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 7/51 (14%)
HMGB-UBF_HMG-box 183..247 CDD:238686 10/60 (17%)
jigr1NP_001097920.1 MADF 33..118 CDD:214738 14/87 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.