DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and tHMG1

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster


Alignment Length:71 Identity:20/71 - (28%)
Similarity:35/71 - (49%) Gaps:4/71 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 RPKKPASAFLRFIAS---ERINTPQGDKQTYREWHQKTTAKWTRLSDSEKEVYMQESRKEMELYR 243
            |||||.|||:.::.|   :.|.....| .:.:|...|....|..::|.:|.|:.:.:...|..|:
  Fly     7 RPKKPMSAFMLWMNSTGRKHIKAEHPD-FSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYK 70

  Fly   244 KAISVW 249
            :.:..|
  Fly    71 EKLKQW 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686
HMGB-UBF_HMG-box 183..247 CDD:238686 18/66 (27%)
tHMG1NP_651055.1 HMGB-UBF_HMG-box 8..74 CDD:238686 18/66 (27%)
Herpes_U55 <55..>116 CDD:253772 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.