powered by:
Protein Alignment TFAM and tHMG1
DIOPT Version :9
Sequence 1: | NP_732527.1 |
Gene: | TFAM / 42433 |
FlyBaseID: | FBgn0038805 |
Length: | 284 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_651055.1 |
Gene: | tHMG1 / 42650 |
FlyBaseID: | FBgn0038978 |
Length: | 126 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 20/71 - (28%) |
Similarity: | 35/71 - (49%) |
Gaps: | 4/71 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 182 RPKKPASAFLRFIAS---ERINTPQGDKQTYREWHQKTTAKWTRLSDSEKEVYMQESRKEMELYR 243
|||||.|||:.::.| :.|.....| .:.:|...|....|..::|.:|.|:.:.:...|..|:
Fly 7 RPKKPMSAFMLWMNSTGRKHIKAEHPD-FSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYK 70
Fly 244 KAISVW 249
:.:..|
Fly 71 EKLKQW 76
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1641977at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.