DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and tox2

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_017211947.1 Gene:tox2 / 405844 ZFINID:ZDB-GENE-040426-2095 Length:459 Species:Danio rerio


Alignment Length:229 Identity:44/229 - (19%)
Similarity:83/229 - (36%) Gaps:55/229 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DTDHR--PLTPPRPLAAASISNTPAVPSKTLEEQLGLPPRPKKPLTPYFRFMREQRPKLKAANPQ 102
            |.|:.  |:|||         |.|..|...|             :.|...::....|.....||.
Zfish   103 DEDYEIPPITPP---------NHPEPPLLHL-------------MDPESSYLCHSIPHNGLINPY 145

  Fly   103 ITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIYVEERTKYDATLTEEQRAEI---KQLKQDL 164
                        ::.:..|.:...:.|:               |..|...|...|   |:...|:
Zfish   146 ------------SYPELPALMMTNMLAQ---------------DGHLLSSQMPSITGEKRPSSDM 183

  Fly   165 VDAKERRQLRKRVKELGRPKKPASAF-LRFIASERINTPQGDKQTYREWHQKTTAKWTRLSDSEK 228
            :..|.:.|.:|:.|:...|:||.||: |.|..::.....|....|:.:..:...:.|..|.:.:|
Zfish   184 MKPKPKPQKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGDVSKIVASMWDSLGEEQK 248

  Fly   229 EVYMQESRKEMELYRKAISVWEEKMIRLGHIDVV 262
            :.|.:::....:.|.||::.:...::...:.|.|
Zfish   249 QAYKRKTEAAKKEYLKALAAYRASLVSKTYSDPV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 6/63 (10%)
HMGB-UBF_HMG-box 183..247 CDD:238686 16/64 (25%)
tox2XP_017211947.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.