DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and ubtfl

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_957297.1 Gene:ubtfl / 393978 ZFINID:ZDB-GENE-040426-1159 Length:719 Species:Danio rerio


Alignment Length:191 Identity:46/191 - (24%)
Similarity:89/191 - (46%) Gaps:48/191 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 PPRPKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIYV 139
            |..|||||||||||..|:|.|....:|:::.:::.:.|||.:.:...:.|.:...||:|:::.: 
Zfish   111 PDFPKKPLTPYFRFFMEKRAKYAKIHPEMSNLDLTKILSKKYKELPEKKKLKYIQEFQREKESF- 174

  Fly   140 EERTKYDATLTEEQRAEIKQLKQDLVDAKERRQLRKRVKELGRPKKPASAFLRFIASERINTPQ- 203
                       |:..|..|:...||::.:::..|         |:||             .||| 
Zfish   175 -----------EKNMARFKEDHPDLIEERKKSDL---------PEKP-------------KTPQQ 206

  Fly   204 ----GDKQTYREWHQKTTAK---------WTRLSDSEKEVYMQESRKEMELYRKAISVWEE 251
                .:|:||.:.|.:.:.|         |::|||.::..::.::.:..:.|...:..:.|
Zfish   207 LWYNHEKKTYMKIHPEVSQKELKEALRRQWSQLSDKKRLKWISKALELQKHYEDTMRAYIE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 22/63 (35%)
HMGB-UBF_HMG-box 183..247 CDD:238686 16/77 (21%)
ubtflNP_957297.1 HMGB-UBF_HMG-box 114..179 CDD:238686 23/76 (30%)
HMGB-UBF_HMG-box 198..263 CDD:238686 16/77 (21%)
HMGB-UBF_HMG-box 299..359 CDD:238686
HMG-box 433..509 CDD:294061
HMGB-UBF_HMG-box 527..589 CDD:238686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.