DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and CG12104

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster


Alignment Length:216 Identity:43/216 - (19%)
Similarity:75/216 - (34%) Gaps:52/216 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GSLINKVRQVVAKDWPPS---------DPSRANDTDHRPLTPPRPLAAASISNTPAVPSKTLEEQ 71
            |..:.::....|:...||         |.|..||.|.....   ..|:....|....|.:  ::.
  Fly    10 GDEVFELTDTPAESQSPSQASRRMLSLDQSMLNDDDEENCD---TYASGGGQNLLVQPEQ--QQN 69

  Fly    72 LGLPPRPKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQ 136
            ..:...|.|||.|:..|.|:....:|..||..:..::...:...|...|...|.......:::::
  Fly    70 QAMAQAPPKPLAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKR 134

  Fly   137 IYVEERTKYDATLTEEQ---RAE--------------------IKQLKQDLVDAK---------- 168
            .||.....|...|:|.:   .||                    ::.|:|. |||:          
  Fly   135 EYVRLMRGYRHQLSESEGTSEAEAPPAVATNQPPPLVTTKLESVEDLQQS-VDAQQEPPPDQIQL 198

  Fly   169 --ERRQLRKRVKELGRPKKPA 187
              |..:::|..:|  :..|||
  Fly   199 LTEAARVQKCTRE--QCNKPA 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 15/63 (24%)
HMGB-UBF_HMG-box 183..247 CDD:238686 3/5 (60%)
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 15/63 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.