Sequence 1: | NP_732527.1 | Gene: | TFAM / 42433 | FlyBaseID: | FBgn0038805 | Length: | 284 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001005395.1 | Gene: | ubtf / 368509 | ZFINID: | ZDB-GENE-030616-252 | Length: | 735 | Species: | Danio rerio |
Alignment Length: | 270 | Identity: | 61/270 - (22%) |
---|---|---|---|
Similarity: | 104/270 - (38%) | Gaps: | 92/270 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 75 PPRPKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIYV 139
Fly 140 EERTKY-----------------------------------------DAT--------------- 148
Fly 149 -----------------LTEE-------QRAEIKQLKQDLVDA---KERRQLRKRVKELGRPKKP 186
Fly 187 ASAFLRFIASERINTPQGDKQTYREWHQKTTAKWTRLSDSEKEVYMQ--ESRK---EMELYRKAI 246
Fly 247 SVWEEKMIRL 256 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
TFAM | NP_732527.1 | HMGB-UBF_HMG-box | 78..142 | CDD:238686 | 22/63 (35%) |
HMGB-UBF_HMG-box | 183..247 | CDD:238686 | 17/68 (25%) | ||
ubtf | NP_001005395.1 | HMGB-UBF_HMG-box | 104..168 | CDD:238686 | 22/63 (35%) |
HMGB-UBF_HMG-box | 189..254 | CDD:238686 | 6/64 (9%) | ||
HMGB-UBF_HMG-box | 292..351 | CDD:238686 | 14/60 (23%) | ||
HMGB-UBF_HMG-box | 400..463 | CDD:238686 | |||
HMG_box_5 | 469..552 | CDD:291548 | |||
HMGB-UBF_HMG-box | 557..621 | CDD:238686 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5648 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |