DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and ubtf

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001005395.1 Gene:ubtf / 368509 ZFINID:ZDB-GENE-030616-252 Length:735 Species:Danio rerio


Alignment Length:270 Identity:61/270 - (22%)
Similarity:104/270 - (38%) Gaps:92/270 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 PPRPKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIYV 139
            |..|||||||||||..|:|.|....:|:::.:::.:.|||.:.:...:.||:...:|.|:::.::
Zfish   101 PDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPDRKKEKYVKDFLREKETFM 165

  Fly   140 EERTKY-----------------------------------------DAT--------------- 148
            ....|:                                         |||               
Zfish   166 LSMMKFKQEHPDLLENVNKKSNVPEKAKTPQQLWYSHEKKAFLKAHPDATTKDIKDNLGKQWPQL 230

  Fly   149 -----------------LTEE-------QRAEIKQLKQDLVDA---KERRQLRKRVKELGRPKKP 186
                             |.||       |..|:...:.|:|.:   |..|||:.:..  |||.||
Zfish   231 SDKKRIKWIAKSLEQHKLYEEKMREFIQQHPEMNMTQGDIVKSSLTKAERQLKDKFD--GRPDKP 293

  Fly   187 ASAFLRFIASERINTPQGDKQTYREWHQKTTAKWTRLSDSEKEVYMQ--ESRK---EMELYRKAI 246
            .|.......:|.:::.:....|.|  ....:.:|..|..:||:.|.:  |.:|   |:|:.|..:
Zfish   294 PSNGYSLFCAELMSSMKDVPSTER--MVMCSQRWKLLKQAEKDAYQKRCEQKKKEYEVEMNRYLL 356

  Fly   247 SVWEEKMIRL 256
            |:.||:..|:
Zfish   357 SISEEEQQRI 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 22/63 (35%)
HMGB-UBF_HMG-box 183..247 CDD:238686 17/68 (25%)
ubtfNP_001005395.1 HMGB-UBF_HMG-box 104..168 CDD:238686 22/63 (35%)
HMGB-UBF_HMG-box 189..254 CDD:238686 6/64 (9%)
HMGB-UBF_HMG-box 292..351 CDD:238686 14/60 (23%)
HMGB-UBF_HMG-box 400..463 CDD:238686
HMG_box_5 469..552 CDD:291548
HMGB-UBF_HMG-box 557..621 CDD:238686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.