DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and Hmg20b

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006241006.1 Gene:Hmg20b / 362825 RGDID:1309235 Length:344 Species:Rattus norvegicus


Alignment Length:253 Identity:55/253 - (21%)
Similarity:98/253 - (38%) Gaps:61/253 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PSDPSRANDTDHRPLTPPRPLAAASISNTPAVPSKTLEEQLGLPPRPKKPLTPYFRFMREQRPKL 96
            |:..|::....|.||..|     ......|    |..:.:..||..||.|:|.|.||:.|:|.::
  Rat    59 PAHSSQSPSQGHSPLLQP-----VKKRGWP----KGKKRKKILPNGPKAPVTGYVRFLNERREQI 114

  Fly    97 KAANPQITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIYVEERTKYDAT----LTEEQRAEI 157
            :..:|.:...|:.:.|...||......|:|...|.::::|.|::|...|..:    :..|:..|.
  Rat   115 RTRHPDLPFPEITKMLGAEWSKLQPAEKQRYLDEAEKEKQQYLKELWAYQQSEAYKVCTEKIQEN 179

  Fly   158 KQLKQDL--------------VDAKE--------------RRQLRKRVKELGRPKKPASAFLRFI 194
            |..|:|.              ||..:              ..|.:.|..||.|.:|...||    
  Rat   180 KIKKEDSSSGLMNTLLNGHKGVDCGDGFSTFDVPIFTEEFLDQNKAREAELRRLRKMNVAF---- 240

  Fly   195 ASERINTPQGDKQTYREWHQKTTAKWTRLSDSEKEVYMQESR-----KEMELYRKAIS 247
                    :......:...|...:...||   |:|:.::|.|     ::::..|:|::
  Rat   241 --------EEQNAVLQRHTQSMNSARERL---EQELALEERRTLALQQQLQAVRQALT 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 19/63 (30%)
HMGB-UBF_HMG-box 183..247 CDD:238686 12/68 (18%)
Hmg20bXP_006241006.1 NHP6B 26..229 CDD:227935 40/178 (22%)
HMGB-UBF_HMG-box 96..160 CDD:238686 19/63 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.