DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and CG32202

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_730354.2 Gene:CG32202 / 326199 FlyBaseID:FBgn0052202 Length:141 Species:Drosophila melanogaster


Alignment Length:98 Identity:22/98 - (22%)
Similarity:35/98 - (35%) Gaps:23/98 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 INKVRQVVAKDWPPSDPSRANDT------------DHR--PLTPPRPLAAASISNT-PAVPSKTL 68
            :|.::::|.:        |.:|.            |.|  |:..|.|......... |...:|..
  Fly    35 VNGIKKIVRR--------RNHDVELLKRRLDKHGDDWRSVPMEAPHPKGKTEQKRRGPKPKNKQA 91

  Fly    69 EEQLGLPPRPKKPLTPYFRFMREQRPKLKAANP 101
            .::.|.|.....|.||..|..|:|:.|....||
  Fly    92 ADETGAPGSEPGPNTPAARKPRKQKAKQAPINP 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 9/24 (38%)
HMGB-UBF_HMG-box 183..247 CDD:238686
CG32202NP_730354.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.