DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and Hmg20a

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006243179.1 Gene:Hmg20a / 315689 RGDID:1564760 Length:350 Species:Rattus norvegicus


Alignment Length:191 Identity:54/191 - (28%)
Similarity:81/191 - (42%) Gaps:25/191 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 PKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIYVEER 142
            ||.|||.|.|||.|:|.:|:|..|::...|:.|.|...||....:.|:|...|..||::.|::|.
  Rat   106 PKSPLTGYVRFMNERREQLRAKRPEVPFPEITRMLGNEWSKLPPEEKQRYLDEADRDKERYMKEL 170

  Fly   143 TKYDATLTEEQRAEIKQLKQDLVDAKERRQLRKRVKELGRPK----KPASAF-LRFIASERINTP 202
            .:|..|   |......:..||....|..||...|.......|    |..|.| :.....|.:|..
  Rat   171 EQYQKT---EAYKVFSRKTQDRQKGKSHRQDAARQATHDHEKETEVKERSVFDIPIFTEEFLNHS 232

  Fly   203 QGDKQTYREWHQKTTAKWTRLSDSEKEVYMQESRKEMELYRKAISVWEEKMIRLGHIDVVR 263
            :..:...|:         .|.|:.|.|......:|.:|..|.|:    ||:    .:||::
  Rat   233 KAREAELRQ---------LRKSNMEFEERNAALQKHVESMRTAV----EKL----EVDVIQ 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 25/63 (40%)
HMGB-UBF_HMG-box 183..247 CDD:238686 15/68 (22%)
Hmg20aXP_006243179.1 HMGB-UBF_HMG-box 106..171 CDD:238686 26/64 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.