DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and HMGB3

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001288160.1 Gene:HMGB3 / 3149 HGNCID:5004 Length:220 Species:Homo sapiens


Alignment Length:220 Identity:53/220 - (24%)
Similarity:87/220 - (39%) Gaps:48/220 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GLPPRPKKPLTPYFRFMREQRPKLKAANPQITT--VEVVRQLSKNWSDADAQLKERLQAEFKRDQ 135
            |.|.:||..::.|..|::..|.:.|..||::..  .|..::.|:.|.....:.|.:.....|.| 
Human    24 GDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKFDEMAKAD- 87

  Fly   136 QIYVEERTKYDATLTEEQRAEIKQLKQDLVDAKERRQLRKRVKELGRPKKPASAFLRF------- 193
                  :.:||           :::| |...||.    .|:.|:...||:|.|.|..|       
Human    88 ------KVRYD-----------REMK-DYGPAKG----GKKKKDPNAPKRPPSGFFLFCSEFRPK 130

  Fly   194 IASERINTPQGDKQTYREWHQKTTAKWTRLSDSEKEVYMQESRKEMELYRKAISVWEEKMIRLGH 258
            |.|.......||..      :|....|..|:||||:.|:.::.|..|.|.|.::.::.|    |.
Human   131 IKSTNPGISIGDVA------KKLGEMWNNLNDSEKQPYITKAAKLKEKYEKDVADYKSK----GK 185

  Fly   259 IDVVRHGNLIDPPEPKPRKTLASKD 283
            .|..:      .|....||.:..:|
Human   186 FDGAK------GPAKVARKKVEEED 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 14/65 (22%)
HMGB-UBF_HMG-box 183..247 CDD:238686 22/70 (31%)
HMGB3NP_001288160.1 HMG_box_2 33..98 CDD:370242 15/83 (18%)
HMG_box 113..180 CDD:366139 22/72 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.