DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and HMGB1

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001300821.1 Gene:HMGB1 / 3146 HGNCID:4983 Length:215 Species:Homo sapiens


Alignment Length:214 Identity:46/214 - (21%)
Similarity:82/214 - (38%) Gaps:41/214 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GLPPRPKKPLTPYFRFMREQRPKLKAANP--QITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQ 135
            |.|.:|:..::.|..|::..|.:.|..:|  .:...|..::.|:.|....|:.|.:.:...|.|:
Human     4 GDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADK 68

  Fly   136 QIYVEERTKYDATLTEEQRAEIKQLKQDLVDAKERRQLRKRVKELGRPKKPASAFLRF------- 193
            ..|..|...|                     ...:.:.:|:.|:...||:|.|||..|       
Human    69 ARYEREMKTY---------------------IPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPK 112

  Fly   194 IASERINTPQGDKQTYREWHQKTTAKWTRLSDSEKEVYMQESRKEMELYRKAISVWEEKMIRLGH 258
            |..|......||..      :|....|...:..:|:.|.:::.|..|.|.|.|:.:..|    |.
Human   113 IKGEHPGLSIGDVA------KKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK----GK 167

  Fly   259 IDVVRHGNLIDPPEPKPRK 277
            .|..:.| ::...:.|.:|
Human   168 PDAAKKG-VVKAEKSKKKK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 14/65 (22%)
HMGB-UBF_HMG-box 183..247 CDD:238686 19/70 (27%)
HMGB1NP_001300821.1 Sufficient for interaction with HAVCR2. /evidence=ECO:0000250|UniProtKB:P63158 1..97 21/113 (19%)
Heparin-binding. /evidence=ECO:0000250|UniProtKB:P10103 1..10 2/5 (40%)
LPS binding (delipidated). /evidence=ECO:0000269|PubMed:21660935 3..15 3/10 (30%)
HMG_box_2 6..78 CDD:401091 16/71 (23%)
Nuclear localization signal (NLS) 1. /evidence=ECO:0000250|UniProtKB:P63159 27..43 3/15 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..95 3/39 (8%)
LPS binding (Lipid A). /evidence=ECO:0000269|PubMed:21660935 80..96 2/15 (13%)
Cytokine-stimulating activity. /evidence=ECO:0000269|PubMed:12765338 89..108 8/18 (44%)
HMG_box 95..162 CDD:395407 20/72 (28%)
Binding to AGER/RAGE. /evidence=ECO:0000250|UniProtKB:P63159 150..183 9/37 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..215 6/30 (20%)
Nuclear localization signal (NLS) 2. /evidence=ECO:0000250|UniProtKB:P63159 178..184 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.