DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and Hmgxb4

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001100882.1 Gene:Hmgxb4 / 307667 RGDID:1305783 Length:598 Species:Rattus norvegicus


Alignment Length:237 Identity:49/237 - (20%)
Similarity:98/237 - (41%) Gaps:58/237 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 QRPKLKAANPQITTVEVVRQLSKNWS------------DADAQLKER---LQAEFKRDQQIYVEE 141
            |.|:..:||..||.::.:...|::.|            |:..::|::   .:::.|:|:..:.|:
  Rat   273 QLPEPHSANLDITGLDPILVESESSSAGELEAGELVIDDSYREIKKKKKSKKSKKKKDKDRHKEK 337

  Fly   142 ---RTKYDAT----------LTEEQRAEIKQLKQDLV------DAKERRQLRKRVKELG-RPKKP 186
               |||..:|          |.....:.|..|....:      :.|::::.:.|.:|.| :|||.
  Rat   338 RHSRTKRSSTREHGTAREHMLVSSPASSIPTLPLPALHTDGHGEKKKKKEEKDRERERGEKPKKK 402

  Fly   187 -ASAFLRFIASERI----NTPQGDKQTYREWHQKTTAKWTRLSDSEKEV------YMQESRKEME 240
             .||:..|....|:    :.|..|   :.|..:|....|.:|.:.:|.:      |:|..:.:.|
  Rat   403 NMSAYQVFCKEYRVTIVADHPGID---FGELSKKLAEVWKQLPEKDKLIWKQKAQYLQHKQNKAE 464

  Fly   241 ---LYRKAISVWEEKMIRLGHIDVVRHGNLIDPPEPKPRKTL 279
               :.|||.|......:|...:      .::.|.:..|..|:
  Rat   465 ATTVKRKASSAEGTMKVRASSV------GILSPQKKSPPTTM 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 13/67 (19%)
HMGB-UBF_HMG-box 183..247 CDD:238686 20/77 (26%)
Hmgxb4NP_001100882.1 DUF4171 107..225 CDD:290491
HMG-box 400..463 CDD:238037 15/65 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.