DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and Hmgb3

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_003751730.1 Gene:Hmgb3 / 305373 RGDID:1564407 Length:241 Species:Rattus norvegicus


Alignment Length:231 Identity:58/231 - (25%)
Similarity:92/231 - (39%) Gaps:46/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SRANDTDH-----RPLTPPRPLAAASISNTPAVPSKTLEEQLGLPPRPKKPLTPYFRFMREQRPK 95
            |.|:.|.|     |.|..|.|.   |:.........::....|.|.:||..::.|..|::..|.:
  Rat     6 SGAHTTFHPRLHSRVLATPSPF---SLLGGREGRRHSVRMAKGDPKKPKGKMSAYAFFVQTCREE 67

  Fly    96 LKAANPQITT--VEVVRQLSKNWSDADAQLKERLQAEFKRDQQIYVEERTKYDATLTEEQRAEIK 158
            .|..||::..  .|..::.|:.|....::.|.:.....|.|       :.:||           :
  Rat    68 HKKKNPEVPVNFAEFSKKCSERWKTMSSKEKSKFDEMAKAD-------KVRYD-----------R 114

  Fly   159 QLKQDLVDAKERRQLRKRVKELGRPKKPASAFLRF-------IASERINTPQGDKQTYREWHQKT 216
            ::| |...||.    .|:.|:...||:|.|.|..|       |.|.......||..      :|.
  Rat   115 EMK-DYGPAKG----GKKKKDPNAPKRPPSGFFLFCSEFRPKIKSANPGISIGDVA------KKL 168

  Fly   217 TAKWTRLSDSEKEVYMQESRKEMELYRKAISVWEEK 252
            ...|..||||||:.||.::.|..|.|.|.::.::.|
  Rat   169 GEMWNNLSDSEKQPYMTKAAKLKEKYEKDVADYKSK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 14/65 (22%)
HMGB-UBF_HMG-box 183..247 CDD:238686 24/70 (34%)
Hmgb3XP_003751730.1 HMG_box_2 54..119 CDD:286146 15/83 (18%)
HMG_box 134..201 CDD:278906 24/72 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.