DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and RGD1565762

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_038947123.1 Gene:RGD1565762 / 297853 RGDID:1565762 Length:191 Species:Rattus norvegicus


Alignment Length:75 Identity:23/75 - (30%)
Similarity:39/75 - (52%) Gaps:4/75 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 PAVPSKTLEEQLGLPPRPKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSK---NWSDADAQ 122
            || |.:..|::...|...|:|.:.:|.|..|.|||:|..:|.::..:..::|.:   |.:..|.|
  Rat   109 PA-PKEETEKKFKYPNASKRPPSAFFLFCSEYRPKIKGEHPGLSIGDAAKKLGEMGNNTAPVDKQ 172

  Fly   123 LKERLQAEFK 132
            |.|:...|.|
  Rat   173 LYEKKATELK 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 18/58 (31%)
HMGB-UBF_HMG-box 183..247 CDD:238686
RGD1565762XP_038947123.1 HMG-box 35..107 CDD:412149
HMG_box 126..191 CDD:395407 18/57 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.