powered by:
Protein Alignment TFAM and RGD1565762
DIOPT Version :9
Sequence 1: | NP_732527.1 |
Gene: | TFAM / 42433 |
FlyBaseID: | FBgn0038805 |
Length: | 284 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_038947123.1 |
Gene: | RGD1565762 / 297853 |
RGDID: | 1565762 |
Length: | 191 |
Species: | Rattus norvegicus |
Alignment Length: | 75 |
Identity: | 23/75 - (30%) |
Similarity: | 39/75 - (52%) |
Gaps: | 4/75 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 61 PAVPSKTLEEQLGLPPRPKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSK---NWSDADAQ 122
|| |.:..|::...|...|:|.:.:|.|..|.|||:|..:|.::..:..::|.: |.:..|.|
Rat 109 PA-PKEETEKKFKYPNASKRPPSAFFLFCSEYRPKIKGEHPGLSIGDAAKKLGEMGNNTAPVDKQ 172
Fly 123 LKERLQAEFK 132
|.|:...|.|
Rat 173 LYEKKATELK 182
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR48112 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.