DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and Sox13

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006249824.1 Gene:Sox13 / 289026 RGDID:1309674 Length:613 Species:Rattus norvegicus


Alignment Length:258 Identity:60/258 - (23%)
Similarity:103/258 - (39%) Gaps:47/258 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PPSD-PSRANDTDHRPL-TPPRPL---AAASISNTPAVPSKTLEEQLGLPPRPKKPLTPYFRFMR 90
            ||:. ..|.....|.|| .||:||   |...:|..|...|....:.....|||.....| .|.::
  Rat   262 PPAPVVKRPGVATHHPLQEPPQPLNLTAKPKVSELPNTSSSPSLKMNSCGPRPSSHGAP-TRDLQ 325

  Fly    91 EQRPKLK----AANPQIT-TVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIYVEERTKYDATLT 150
            ...|.|.    .....:| .::..|||..:.|.|   |:....|.|::|       ....|::..
  Rat   326 SSPPNLPLGFLGEGDAVTKAIQDARQLLHSHSGA---LENSPSAPFRKD-------LISLDSSPA 380

  Fly   151 EEQRAE--IKQLKQDLV--DAKERRQLRKRVKELGRPKKPASAFLRFIASERINTPQGDKQTYRE 211
            :|:..|  :..|::.::  |....|...:. :.....|:|.:||:.:...||    :...|.:.:
  Rat   381 KERLEENCVHPLEEAMLGCDVDGSRHFSES-RNSSHIKRPMNAFMVWAKDER----RKILQAFPD 440

  Fly   212 WHQKTTAK-----WTRLSDSEKEVYMQE----SRKEMELY--------RKAISVWEEKMIRLG 257
            .|..:.:|     |..:::.||:.|.:|    ||:.:|.|        .|...|.|.:.:|:|
  Rat   441 MHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPKRTCVVEGRRLRVG 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 15/68 (22%)
HMGB-UBF_HMG-box 183..247 CDD:238686 19/80 (24%)
Sox13XP_006249824.1 Herpes_UL46 <251..>419 CDD:355696 38/168 (23%)
SOX-TCF_HMG-box 415..486 CDD:238684 18/74 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.