DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and TOX3

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001073899.2 Gene:TOX3 / 27324 HGNCID:11972 Length:576 Species:Homo sapiens


Alignment Length:148 Identity:37/148 - (25%)
Similarity:66/148 - (44%) Gaps:15/148 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AKDWPPSDPSRANDTD----HRPLTPPRPLAAASISNTPAVPSKTLEEQLGLPPRPKKPLTPYFR 87
            :|...||..|..|:.|    :|.:...|  ||......|..|.|..::.   |..|:||::.|..
Human   205 SKSATPSPSSSINEEDADEANRAIGEKR--AAPDSGKKPKTPKKKKKKD---PNEPQKPVSAYAL 264

  Fly    88 FMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIYVEERTKYDATLTEE 152
            |.|:.:..:|..||..|..||.:.::..|.....:.|:..:.:.:..::.|::....|.|:|..:
Human   265 FFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLKALAAYRASLVSK 329

  Fly   153 QRAE------IKQLKQDL 164
            ..||      |:.::|.|
Human   330 AAAESAEAQTIRSVQQTL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 15/63 (24%)
HMGB-UBF_HMG-box 183..247 CDD:238686
TOX3NP_001073899.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..258 15/57 (26%)
HMG-box 255..320 CDD:238037 15/64 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 422..443
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 519..563
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.