DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and Tox2

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001359507.1 Gene:Tox2 / 269389 MGIID:3611233 Length:541 Species:Mus musculus


Alignment Length:289 Identity:53/289 - (18%)
Similarity:101/289 - (34%) Gaps:71/289 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IYTTTLMSSRGGLIGSLINKVRQVVAKDWPPSDPSRANDTDHRPLTPPRPLAAASISNTPAVPSK 66
            |..:.:::..|.|:...:..::::|..:....|..|......||        |...|:..|:...
Mouse   144 IMVSNMLAQDGHLLSGQLPTIQEMVHSEVAAYDSGRPGPLLGRP--------AMLASHMSALSQS 200

  Fly    67 TLEEQLGL-------PPRPKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQLK 124
            .|..|:|:       .|.|               |..|:|.|               |.:.:..:
Mouse   201 QLISQMGIRSGIAHGSPSP---------------PGSKSATP---------------SPSSSTQE 235

  Fly   125 ERLQAEFKRDQQIYVEERTKYDATLTEEQRAEIKQLKQDLVDAKERRQLRKRVKELGRPKKPASA 189
            |...|.||                ::.|:|..:...|      |.:...:|:.|:...|:||.||
Mouse   236 EESDAHFK----------------ISGEKRPSVDPGK------KAKNPKKKKKKDPNEPQKPVSA 278

  Fly   190 F-LRFIASERINTPQGDKQTYREWHQKTTAKWTRLSDSEKEVYMQESRKEMELYRKAISVWEEKM 253
            : |.|..::.....|....|:.:..:...:.|..|.:.:|:.|.:::....:.|.||::.:...:
Mouse   279 YALFFRDTQAAIKGQNPSATFGDVSKIVASMWDSLGEEQKQAYKRKTEAAKKEYLKALAAYRASL 343

  Fly   254 IRLGHIDVVRHGNLIDPPEPKPRKTLASK 282
            :.....|   .|...:.....|.|.|..|
Mouse   344 VSKSPPD---QGEAKNTQANPPAKMLPPK 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 10/63 (16%)
HMGB-UBF_HMG-box 183..247 CDD:238686 16/64 (25%)
Tox2NP_001359507.1 HMG-box 272..337 CDD:238037 16/64 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.