DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and Hmgb1

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_038945039.1 Gene:Hmgb1 / 25459 RGDID:2802 Length:486 Species:Rattus norvegicus


Alignment Length:263 Identity:58/263 - (22%)
Similarity:97/263 - (36%) Gaps:55/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KDWPPSDPSRANDTDHRPLTPPRPLAAASISNTPAVPSKTLEEQL----GLPPRPKKPLTPYFRF 88
            :.|.|    ||     || .|..|..:..:......|....|.||    |.|.:|:..::.|..|
  Rat   236 RTWRP----RA-----RP-EPQPPSTSGQVRRAGNPPRARQENQLNMGKGDPKKPRGKMSSYAFF 290

  Fly    89 MREQRPKLKAANP--QITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIYVEERTKYDATLTE 151
            ::..|.:.|..:|  .:...|..::.|:.|....|:.|.:.:...|.|:..|..|...|      
  Rat   291 VQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTY------ 349

  Fly   152 EQRAEIKQLKQDLVDAKERRQLRKRVKELGRPKKPASAFLRF-------IASERINTPQGDKQTY 209
                           ...:.:.:|:.|:...||:|.|||..|       |..|......||..  
  Rat   350 ---------------IPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVA-- 397

  Fly   210 REWHQKTTAKWTRLSDSEKEVYMQESRKEMELYRKAISVWEEKMIRLGHIDVVRHGNLIDPPEPK 274
                :|....|...:..:|:.|.:::.|..|.|.|.|:.:..|    |..|..:.| ::...:.|
  Rat   398 ----KKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK----GKPDAAKKG-VVKAEKSK 453

  Fly   275 PRK 277
            .:|
  Rat   454 KKK 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 14/65 (22%)
HMGB-UBF_HMG-box 183..247 CDD:238686 19/70 (27%)
Hmgb1XP_038945039.1 HMG_box_2 277..349 CDD:401091 16/71 (23%)
HMG_box 366..433 CDD:395407 20/72 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.