DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and cmb1

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_593693.1 Gene:cmb1 / 2543595 PomBaseID:SPAC4G9.11c Length:223 Species:Schizosaccharomyces pombe


Alignment Length:189 Identity:45/189 - (23%)
Similarity:81/189 - (42%) Gaps:41/189 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LPPRPKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKN-WSDADAQLKERLQAEFKRDQQI 137
            :|||.|       ....:...:.|.|.......|::||..|. .:|...:.|.:||.:|..:::.
pombe    50 IPPRLK-------TIWNQMLVETKGAGNGPERFEMIRQKYKALTADEIQKYKNKLQEQFDAEKKR 107

  Fly   138 YVEERTKYDATLTEEQRAEIKQLKQDLVDAKERRQLRK---------RVKELGRPKKPASAFLRF 193
            ::|  |....|.||             :|::.||:.::         |::....||||:|||:.|
pombe   108 FME--TLRSFTPTE-------------IDSENRRRSKEAHSTGSRYYRLRHPDVPKKPSSAFILF 157

  Fly   194 IASERINTPQGDKQ--------TYREWHQKTTAKWTRLSDSEKEVYMQESRKEMELYRK 244
            ....| |.|:..::        |..|..|..:..|..|::.:|:.::.:|:...|.|.|
pombe   158 YKELR-NNPKLRQELGIPEAISTLVEETQNASKAWKELAEDKKKPFIDKSKALKEQYDK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 13/64 (20%)
HMGB-UBF_HMG-box 183..247 CDD:238686 21/70 (30%)
cmb1NP_593693.1 NHP6B 1..220 CDD:227935 45/189 (24%)
HMGB-UBF_HMG-box 147..218 CDD:238686 21/70 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.