DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and nhp6

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_593314.1 Gene:nhp6 / 2542878 PomBaseID:SPAC57A10.09c Length:108 Species:Schizosaccharomyces pombe


Alignment Length:80 Identity:22/80 - (27%)
Similarity:41/80 - (51%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 PPRPKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIYV 139
            |..||:.::.:..|..|.|.|:|..||..|..::...|.|.|.:..:..:|..:.:.::|::.|.
pombe    13 PNTPKRNMSAFMFFSIENREKMKTDNPDATFGQLGSLLGKRWKELTSTEREPYEEKARQDKERYE 77

  Fly   140 EERTKYDATLTEEQR 154
            .||.:||..|...::
pombe    78 RERKEYDTKLANGEK 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 16/63 (25%)
HMGB-UBF_HMG-box 183..247 CDD:238686
nhp6NP_593314.1 NHP6B <7..>108 CDD:227935 22/80 (28%)
HMGB-UBF_HMG-box 16..81 CDD:238686 17/64 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.